>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170405
Research areas: Tags & Cell Markers
Target / Protein: CEACAM7
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Homo sapiens (Human)
Delivery time: 3-7 business days
Uniprot ID: Q14002
AA Sequence: TNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLIQNVTHNDAGFYTLHVIKENLVNEEVTRQFYVFSEPPKPSITSNNFNPVENKDIVVLTCQPETQNTTYLWWVNNQSLLVSPRLLLSTDNRTLVLLSATKNDIGPYECEIQNPVGASRSDPVTLNVRYESVQAS
Tag info: N-terminal 6xHis-SUMO-tagged
Expression Region: 36-242aa
Protein length: Full Length
MW: 39.4 kDa
Alternative Name(s): Carcinoembryonic antigen CGM2
Relevance:
Reference: "CGM2, a member of the carcinoembryonic antigen gene family is down-regulated in colorectal carcinomas."Thompson J., Zimmermann W., Nollau P., Neumaier M., Weber-Arden J., Schrewe H., Craig I., Willcocks T.J. Biol. Chem. 269:32924-32931(1994)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.