Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Immunology
Uniprot ID: P02778
Gene Names: CXCL10
Organism: Homo sapiens (Human)
AA Sequence: VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
Expression Region: 22-98aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 12.6 kDa
Alternative Name(s): 10KDA interferon gamma-induced protein ;Gamma-IP10 ;IP-10Small-inducible cytokine B10
Relevance: Chotactic for monocytes and T-lymphocytes. Binds to CXCR3.
Reference: Processing of natural and recombinant CXCR3-targeting chemokines and implications for biological activity.Hensbergen P.J., van der Raaij-Helmer E.M.H., Dijkman R., van der Schors R.C., Werner-Felmayer G., Boorsma D.M., Scheper R.J., Willemze R., Tensen C.P.Eur. J. Biochem. 268:4992-4999(2001)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.