Recombinant Human Bone sialoprotein 2 (IBSP),Partial

Recombinant Human Bone sialoprotein 2 (IBSP),Partial

CSB-EP010945HU(A4)
Regular price
€500,95 EUR
Sale price
€500,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: others

Target / Protein: IBSP

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Homo sapiens (Human)

Delivery time: 3-7 business days

Uniprot ID: P21815

AA Sequence: AIQLPKKAGDITNKATKEKESDEEEEEEEEGNENEESEAEVDENEQGINGTSTNSTEAENGNGSSGGDNGEEGEEESVTGANAEDTTETGRQGKGTSKTTTSPNGGFEPTTPPQVYRTTSPPFGKTTTVEYEGEYEYTGANEYDNGYEIYESE

Tag info: N-terminal 6xHis-SUMO-tagged

Expression Region: 129-281aa

Protein length: Partial

MW: 32.4 kDa

Alternative Name(s): Bone sialoprotein II

Relevance: Binds tightly to hydroxyapatite. Appears to form an integral part of the mineralized matrix. Probably important to cell-matrix interaction. Promotes Arg-Gly-Asp-dependent cell attachment.

Reference: "Human bone sialoprotein. Deduced protein sequence and chromosomal localization." Fisher L.W., McBride O.W., Termine J.D., Young M.F. J. Biol. Chem. 265:2347-2351(1990)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Human Bone sialoprotein 2 (IBSP),partial
    Regular price
    €500,95 EUR
    Sale price
    €500,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Biglycan(BGN)
    Regular price
    €500,95 EUR
    Sale price
    €500,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Bone morphogenetic protein 2(BMP2)
    Regular price
    €500,95 EUR
    Sale price
    €500,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human HLA-B protein(HLA-B),partial
    Regular price
    €500,95 EUR
    Sale price
    €500,95 EUR
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share