Recombinant Human adenovirus C serotype 5 Protease(L3)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human adenovirus C serotype 5 Protease(L3)

CSB-EP361000HILb1
Regular price
€781,95 EUR
Sale price
€781,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170725

Research areas: others

Target / Protein: L3

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5)

Delivery time: 3-7 business days

Uniprot ID: P03253

AA Sequence: MGSSEQELKAIVKDLGCGPYFLGTYDKRFPGFVSPHKLACAIVNTAGRETGGVHWMAFAWNPHSKTCYLFEPFGFSDQRLKQVYQFEYESLLRRSAIASSPDRCITLEKSTQSVQGPNSAACGLFCCMFLHAFANWPQTPMDHNPTMNLITGVPNSMLNSPQVQPTLRRNQEQLYSFLERHSPYFRSHSAQIRSATSFCHLKNM

Tag info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 1-204aa

Protein length: Full Length

MW: 28.1 kDa

Alternative Name(s): Adenain Adenovirus protease

Relevance: Cleaves viral precursor proteins (pTP, pIIIa, pVI, pVII, pVIII, and pX) inside newly assembled particles giving rise to mature virions. Protease complexed to its cofactor slides along the viral DNA to specifically locate and cleave the viral precursors. Mature virions have a weakened organization compared to the unmature virions, thereby facilitating subsequent uncoating. Without maturation, the particle lacks infectivity and is unable to uncoat. Late in adenovirus infection, in the cytoplasm, may participate in the cytoskeleton destruction. Cleaves host cell cytoskeletal keratins K7 and K18.

Reference: "De novo derivation of proteomes from transcriptomes for transcript and protein identification." Evans V.C., Barker G., Heesom K.J., Fan J., Bessant C., Matthews D.A. Nat. Methods 9:1207-1211(2012)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share