Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: P69179
Gene Names: stxB
Organism: Enterobacteria phage H19B (Bacteriophage H19B)
AA Sequence: TPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR
Expression Region: 21-89aa
Sequence Info: Full Length of Mature Protein
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 11.7 kDa
Alternative Name(s): Verocytotoxin 1 subunit B
Relevance: The B subunit is responsible for the binding of the holotoxin to specific receptors on the target cell surface, such as globotriaosylceramide (Gb3) in human intestinal microvilli.
Reference: "Nucleotide sequence and promoter mapping of the Escherichia coli Shiga-like toxin operon of bacteriophage H-19B." de Grandis S., Ginsberg J., Toone M., Climie S., Friesen J., Brunton J.L. J. Bacteriol. 169:4313-4319(1987)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.