Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Canis familiaris (Dog) (Canis lupus familiaris)
Uniprot NO.:Q9BDP4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:AYHGLTVPLIVMSVFWGFVGFCVPWFIPKGPNRGVIITMLVTCSVCCYLFWLIAILAQLN PLFGPQLKNETIWYLKYHWP
Protein Names:Recommended name: V-type proton ATPase subunit e 1 Short name= V-ATPase subunit e 1 Alternative name(s): V-ATPase 9.2 kDa membrane accessory protein V-ATPase M9.2 subunit Vacuolar proton pump subunit e 1
Gene Names:Name:ATP6V0E1 Synonyms:ATP6H, ATP6V0E
Expression Region:2-81
Sequence Info:full length protein