Recombinant Dog C-C motif chemokine 17(CCL17)

Recombinant Dog C-C motif chemokine 17(CCL17)

CSB-EP856825DO
Regular price
€767,95 EUR
Sale price
€767,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:100ug. Other sizes are also available. For further information, please contact us.

Research Areas:Immunology

Uniprot ID:Q95N01

Gene Names:CCL17

Organism:Canis familiaris (Dog) (Canis lupus familiaris)

AA Sequence:ARGTNVGRECCLEYFKGAIPISRLTRWYKTSGECPKDAIVFVTVQGKSICSDPKDKRVKKAVRYLQRTWKGGPQES

Expression Region:24-99aa

Sequence Info:Full Length of Mature Protein

Source:E.coli

Tag Info:N-terminal 6xHis-KSI-tagged

MW:23.9 kDa

Alternative Name(s):CC chemokine TARC;Small-inducible cytokine A17;Thymus and activation-regulated chemokine

Relevance:Chemotactic factor for t lymphocytes but not monocytes or granulocytes. May play a role in T-cell development in thymus and in trafficking and activation of mature T-cells. Binds to CCR4 and CCR8 (By similarity).

Reference:"Molecular cloning of canine thymus and activation-regulated chemokine (TARC) gene and its expression in various tissues." Maeda S., Mizuno T., Yamashita K., Kurata K., Masuda K., Ohno K., Tsujimoto H. J. Vet. Med. Sci. 63:1035-1038(2001)

Purity:Greater than 85% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:

STRING Database Link:

OMIM Database Link:

Lead Time Guidance:3-7 business days

Your list is ready to share