Recombinant Clostridium pasteurianum Rubredoxin(Rd)

Recombinant Clostridium pasteurianum Rubredoxin(Rd)

CSB-EP360387CMA
Regular price
€794,95 EUR
Sale price
€794,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: Others

Target / Protein: Rd

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Clostridium pasteurianum

Delivery time: 3-7 business days

Uniprot ID: P00268

AA Sequence: MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCGVGKDQFEEVEE

Tag info: N-terminal 6xHis-SUMO-tagged

Expression Region: 1-54aa

Protein length: Full Length

MW: 22 kDa

Alternative Name(s): Short name:Rd

Relevance: Rubredoxin is a small nonheme, iron protein lacking acid-labile sulfide. Its single Fe, chelated to 4 Cys, functions as an electron acceptor and may also stabilize the conformation of the molecule.

Reference: "Cloning, sequencing and expression in Escherichia coli of the rubredoxin gene from Clostridium pasteurianum."Mathieu I., Meyer J., Moulis J.-M.Biochem. J. 285:255-262(1992)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share