
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170405
Research areas: Allergen
Target / Protein:
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Carica papaya (Papaya)
Delivery time: 3-7 business days
Uniprot ID: P00784
AA Sequence: IPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNEYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNEGALLYSIANQPVSVVLEAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN
Tag info: N-terminal 6xHis-tagged
Expression Region: 134-345aa
Protein length: Full Length
MW: 27.4 kDa
Alternative Name(s): Papaya proteinase I Short name:PPI
Relevance: Catalytic activityi Hydrolysis of proteins with broad specificity for peptide bonds, but preference for an amino acid bearing a large hydrophobic side chain at the P2 position. Does not accept Val in P1'.
Reference: "Structure of papain."Drenth J., Jansonius J.N., Koekoek R., Swen H.M., Wolthers B.G.Nature 218:929-932(1968)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Carica papaya Papain
- Regular price
- €748,95 EUR
- Sale price
- €748,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Cathepsin F protein(CTSF),partial
- Regular price
- €498,95 EUR
- Sale price
- €498,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Carica papaya Apocytochrome f(petA)
- Regular price
- €1.149,95 EUR
- Sale price
- €1.149,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Neurotrypsin(PRSS12) ,partial
- Regular price
- €637,95 EUR
- Sale price
- €637,95 EUR
- Regular price
-
- Unit price
- per
Sold out