Recombinant Bacillus thuringiensis subsp. Pesticidal crystal protein cry1Ac(cry1Ac),partial

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Bacillus thuringiensis subsp. Pesticidal crystal protein cry1Ac(cry1Ac),partial

CSB-YP356448BDC
Regular price
€823,95 EUR
Sale price
€823,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Others

Uniprot ID: P05068

Gene Names: cry1Ac

Organism: Bacillus thuringiensis subsp. kurstaki

AA Sequence: LYDARNVIKNGDFNNGLSCWNVKGHVDVEEQNNQRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEIENNTDELKFSNCVEEEIYPNNTVTCNDYTVNQEEYGGAYTSRNRGYNEAPSVPADYASVYEEKSYTDGRRENPCEFNRGYRDYTPLPVGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE

Expression Region: 972-1178aa

Sequence Info: Partial

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 25.8 kDa

Alternative Name(s): 133KDA crystal protein;Crystaline entomocidal protoxinInsecticidal delta-endotoxin CryIA(c)

Relevance: Promotes colloidosmotic lysis by binding to the midgut epithelial cells of many lepidopteran larvae.

Reference: Characterized full-length and truncated plasmid clones of the crystal protein of Bacillus thuringiensis subsp. kurstaki HD-73 and their toxicity to Manduca sexta.Adang M.J., Staver M.J., Rocheleau T.A., Leighton J., Barker R.F., Thompson D.V.Gene 36:289-300(1985)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Bacillus thuringiensis subsp. kurstaki Pesticidal crystal protein cry1Ac(cry1Ac),partial
    Regular price
    €750,95 EUR
    Sale price
    €750,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Bacillus thuringiensis subsp. Pesticidal crystal protein cry1Ab(cry1Ab),partial
    Regular price
    €823,95 EUR
    Sale price
    €823,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Bacillus thuringiensis subsp. kurstaki Pesticidal crystal protein cry1Ab(cry1Ab),partial
    Regular price
    €750,95 EUR
    Sale price
    €750,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Bacillus thuringiensis subsp. Kurstaki Pesticidal crystal protein cry1Ia(cry1Ia),partial
    Regular price
    €737,95 EUR
    Sale price
    €737,95 EUR
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share