
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Others
Uniprot ID: P05068
Gene Names: cry1Ac
Organism: Bacillus thuringiensis subsp. kurstaki
AA Sequence: LYDARNVIKNGDFNNGLSCWNVKGHVDVEEQNNQRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEIENNTDELKFSNCVEEEIYPNNTVTCNDYTVNQEEYGGAYTSRNRGYNEAPSVPADYASVYEEKSYTDGRRENPCEFNRGYRDYTPLPVGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
Expression Region: 972-1178aa
Sequence Info: Partial
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
MW: 25.8 kDa
Alternative Name(s): 133KDA crystal protein;Crystaline entomocidal protoxinInsecticidal delta-endotoxin CryIA(c)
Relevance: Promotes colloidosmotic lysis by binding to the midgut epithelial cells of many lepidopteran larvae.
Reference: Characterized full-length and truncated plasmid clones of the crystal protein of Bacillus thuringiensis subsp. kurstaki HD-73 and their toxicity to Manduca sexta.Adang M.J., Staver M.J., Rocheleau T.A., Leighton J., Barker R.F., Thompson D.V.Gene 36:289-300(1985)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Bacillus thuringiensis subsp. kurstaki Pesticidal crystal protein cry1Ac(cry1Ac),partial
- Regular price
- €750,95 EUR
- Sale price
- €750,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Bacillus thuringiensis subsp. Pesticidal crystal protein cry1Ab(cry1Ab),partial
- Regular price
- €823,95 EUR
- Sale price
- €823,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Bacillus thuringiensis subsp. kurstaki Pesticidal crystal protein cry1Ab(cry1Ab),partial
- Regular price
- €750,95 EUR
- Sale price
- €750,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Bacillus thuringiensis subsp. Kurstaki Pesticidal crystal protein cry1Ia(cry1Ia),partial
- Regular price
- €737,95 EUR
- Sale price
- €737,95 EUR
- Regular price
-
- Unit price
- per
Sold out