Recombinant Arabidopsis thaliana Double-stranded RNA-binding protein 5(DRB5)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Arabidopsis thaliana Double-stranded RNA-binding protein 5(DRB5)

CSB-YP815439DOA
Regular price
€822,95 EUR
Sale price
€822,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Immunology

Uniprot ID: Q8GY79

Gene Names: DRB5

Organism: Arabidopsis thaliana (Mouse-ear cress)

AA Sequence: MYKNQLQELAQRSCFNLPSYTCIREGPDHAPRFKASVNFNGEIFESPTYCSTLRQAEHAAAEVSLNVLSSRVPSKSLTAKILDETGIYKNLLQETAHRAGLDLPMYTSVRSGSCHFPGFSCTVELAGMTFTGESAKTKKQAEKNAAIAAWSSLKKMSSLDSQDEEKEQEAVARVLSRFKPKEVRRRETTNQWRRRTSQQDSNKDLLIERLRWINLLTNQASSSSSTSTPNQHKNSSFISLIPPPPPPKSSKILPFIQQYKDRSSQEAKTETATEMINSKAKVNETSTRLSKQMPFSDMNRYNFVGGCSVNPYSLAPAVQMRSVIPVFAAPPPKPNPNLNPSSLSSSVNEFTSSNNSCSVLNTPGLGGQEKKNLTREMIKLGSESRILDQTHDS

Expression Region: 1-393aa

Sequence Info: Full Length

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 45.6 kDa

Alternative Name(s): dsRNA-binding protein 5 Short name: AtDRB5

Relevance: Binds double-stranded RNA. May be involved in RNA-mediated silencing.

Reference: "Structural analysis of Arabidopsis thaliana chromosome 5. IV. Sequence features of the regions of 1,456,315 bp covered by nineteen physically assigned P1 and TAC clones."Sato S., Kaneko T., Kotani H., Nakamura Y., Asamizu E., Miyajima N., Tabata S.DNA Res. 5:41-54(1998)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Arabidopsis thaliana Dehydration-responsive element-binding protein 2C(DREB2C)
    Regular price
    €737,95 EUR
    Sale price
    €737,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Arabidopsis thaliana Trihelix transcription factor GT-1(GT-1)
    Regular price
    €750,95 EUR
    Sale price
    €750,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Arabidopsis thaliana Trihelix transcription factor GT-1(GT-1)
    Regular price
    €822,95 EUR
    Sale price
    €822,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Arabidopsis thaliana At1g09870/F21M12_26(At1g09870)
    Regular price
    €737,95 EUR
    Sale price
    €737,95 EUR
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share