Recombinant Alginate lyase(algL)

Recombinant Alginate lyase(algL)

CSB-EP524422DPX
Regular price
€749,95 EUR
Sale price
€749,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: others

Target / Protein: algL

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Azotobacter vinelandii

Delivery time: 3-7 business days

Uniprot ID: O52195

AA Sequence: AEALVPPKGYYAPVDIRKGEAPACPVVPEPFTGELVFRSKYEGSDAARSTLNEEAEKAFRTKTAPITQIERGVSRMVMRYMEKGRAGDLECTLAWLDAWAEDGALLTTEYNHTGKSMRKWALGSLAGAYLRLKFSSSQPLAAYPEQARRIESWFAKVGDQVIKDWSDLPLKRINNHSYWAAWAVMAAGVATNRRPLFDWAVEQFHIAAGQVDSNGFLPNELKRRQRALAYHNYSLPPLMMVAAFALANGVDLRGDNDGALGRLAGNVLAGVEKPEPFAERAGDEDQDMEDLETDAKFSWLEPYCALYSCSPALRERKAEMGPFKNFRLGGDVTRIFDPAEKSPRSTVGKRD

Tag info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Expression Region: 24-374aa

Protein length: Full Length of Mature Protein

MW: 59 kDa

Alternative Name(s): Poly(beta-D-mannuronate) lyase

Relevance: Catalyzes the depolymerization of alginate by cleaving the beta-1,4 glycosidic bond between two adjacent sugar residues via a beta-elimination mechanism. Splits ManA-ManA and ManA-GulA bonds, but not GulA-ManA or GulA-GulA bonds. Also cleaves acetylated residues. May serve to degrade mislocalized alginate that is trapped in the periplasmic space

Reference: "Biochemical properties and substrate specificities of a recombinantly produced Azotobacter vinelandii alginate lyase." Ertesvag H., Erlien F., Skjak-Braek G., Rehm B.H., Valla S. J. Bacteriol. 180:3779-3784(1998)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Human GLA
    Regular price
    €399,95 EUR
    Sale price
    €399,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human AFG3L2
    Regular price
    €470,95 EUR
    Sale price
    €470,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human LRG1
    Regular price
    €470,95 EUR
    Sale price
    €470,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human BLNK
    Regular price
    €641,95 EUR
    Sale price
    €641,95 EUR
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share